PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009616483.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 352aa    MW: 39648.9 Da    PI: 6.8497
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009616483.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.56.4e-34194251259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s++prsYYrCts++Cpvkk+vers +dp++v++tYeg+Hnh+
  XP_009616483.1 194 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCPVKKRVERSYQDPSIVITTYEGQHNHH 251
                     8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-35179253IPR003657WRKY domain
SuperFamilySSF1182906.54E-30185253IPR003657WRKY domain
PROSITE profilePS5081132.661188253IPR003657WRKY domain
SMARTSM007749.9E-40193252IPR003657WRKY domain
PfamPF031061.5E-26194251IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MADEIRDFYY HQPFQEDIRL GYNNLYSQSR VGDNNDSSSV VQNIHMLDPS FMSYTTTHEF  60
LHGSSSDYAN SLGKPFGFSA PSTPSDQAFS SIIKDHDVKP VLDAINNDVI VGGGSETPVT  120
PNSSISNSSS NDAVGDDQDS NKTTNNTKKD KEVKESLEDG EDASKKENKA KKKEKTQRPP  180
KFAFMTKSEV DHLEDGYRWR KYGQKAVKNS PYPRSYYRCT SQKCPVKKRV ERSYQDPSIV  240
ITTYEGQHNH HLPSTLRGNV ARMLNPSMLS TPSPLIAAPR AFHEQVLMNM AQMPHQFYGS  300
SAFGINPPTN SSSNMYHQNV ITPHELQQQL QYSPDYGLLQ DMVPSMFLKQ EP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-271862541078Probable WRKY transcription factor 4
1wj2_A3e-271862541078Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754413e-46HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755143e-46HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616483.10.0PREDICTED: probable WRKY transcription factor 71
RefseqXP_016459945.10.0PREDICTED: probable WRKY transcription factor 71
TrEMBLM1AL071e-127M1AL07_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000251131e-127(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14852475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.16e-58WRKY DNA-binding protein 28